PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.148830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 339aa    MW: 38300.4 Da    PI: 7.7893
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.148830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.16.9e-092743082155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Cucsa.148830.1 274 KWPYPSESQKVALAESTGLDLKQINNWFINQRKRH 308
                     569*****************************885 PP

2ELK39.51.2e-13228249122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  Cucsa.148830.1 228 ELKGQLLRKYSGYLGSLKQEFL 249
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.7E-1796140IPR005540KNOX1
PfamPF037901.3E-2099136IPR005540KNOX1
SMARTSM012567.9E-24143194IPR005541KNOX2
PfamPF037912.9E-21147190IPR005541KNOX2
PfamPF037892.1E-10228249IPR005539ELK domain
PROSITE profilePS5121311.174228248IPR005539ELK domain
SMARTSM011881.2E-7228249IPR005539ELK domain
PROSITE profilePS5007111.92248311IPR001356Homeobox domain
SMARTSM003892.4E-11250315IPR001356Homeobox domain
SuperFamilySSF466898.55E-19250322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-28253313IPR009057Homeodomain-like
CDDcd000865.82E-11260311No hitNo description
PfamPF059205.5E-17268307IPR008422Homeobox KN domain
PROSITE patternPS000270286309IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEGGGSSGSS CSFMATCNST TNNNNSNNTS MMMMMINKTH NNPQTFDNKM FLPLSWSSST  60
SNNNNNNNVQ TQTPLSAFLP QPHTNNSNDH VVPPTSTSKA KIMAHPLFPR LLTAYVNCQK  120
VGAPPEVVAR LEQACAVATG SCRAAGHGND PALDQFMEAY CEMLTKYEQE LTKPFKEAML  180
FFSRIESQLK AEAVSSDGFE LVGQNECSKE IEVDMNENYI DPQAEVKELK GQLLRKYSGY  240
LGSLKQEFLK KKKNGKLPKE ARQQLLDWWS RHYKWPYPSE SQKVALAEST GLDLKQINNW  300
FINQRKRHWK PTEDMQFVIN FTFSTYETLL FLYLLLNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817921e-177LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132551e-177LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144513.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-108HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0A0K5G50.0A0A0A0K5G5_CUCSA; Uncharacterized protein
STRINGVIT_12s0059g01190.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-98KNOX/ELK homeobox transcription factor